A14052
AMPKA Alpha2 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A14052
- Zusätzliche Namen:
- AMPK|AMPK2|AMPKa2|AMPKA Alpha2|PRKAA
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 62kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- QDLPSYLFPEDPSYDANVIDDEAVKEVCEKFECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLA
- Uniprot:
- P54646
- Synonyme:
- 5'-AMP-activated protein kinase catalytic subunit alpha-2;5'-AMP-activated protein kinase, catalytic alpha-2 chain;ACACA kinase;acetyl-CoA carboxylase kinase;AMP-activated protein kinase alpha-2 subunit variant 2;AMP-activated protein kinase alpha-2 subunit variant 3;AMPK;AMPK alpha 2;AMPK subunit alpha-2;AMPK-alpha-2 chain;AMPK2;AMPKa2;HMGCR kinase;hydroxymethylglutaryl-CoA reductase kinase;PRKAA;protein kinase, AMP-activated, alpha 2 catalytic subunit
- Weitere Details:
- The protein encoded by this gene is a catalytic subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. Studies of the mouse counterpart suggest that this catalytic subunit may control whole-body insulin sensitivity and is necessary for maintaining myocardial energy homeostasis during ischemia.
- Versandbedingungen:
- Blue Ice








