PPA1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14050
Zusätzliche Namen:: HEL-S-66p|IOPPP|PP|PP1|PPA1|SID6-8061
Anwendung:: ELISA, WB
Molekulargewicht:: 37kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKDFAIDIIKSTHDHWKALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTVPTDVDKWFHHQKN
Uniprot:: Q15181
Synonyme:: cytosolic inorganic pyrophosphatase;diphosphate phosphohydrolase;epididymis secretory sperm binding protein Li 66p;HEL-S-66p;inorganic diphosphatase 1;inorganic pyrophosphatase;IOPPP;PP;PP1;PPase;pyrophosphatase (inorganic) 1;pyrophosphatase 1;pyrophosphate phospho-hydrolase;SID6-8061
Weitere Details:: The protein encoded by this gene is a member of the inorganic pyrophosphatase (PPase) family. PPases catalyze the hydrolysis of pyrophosphate to inorganic phosphate, which is important for the phosphate metabolism of cells. Studies of a similar protein in bovine suggested a cytoplasmic localization of this enzyme.