A1404
S1PR3 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A1404
- Zusätzliche Namen:
- bA791O21.3|C9orf108|C9orf47|EDG-3|EDG3|LPB3|S1P3|S1PR3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 42kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMVLIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSG
- Uniprot:
- Q99500
- Synonyme:
- bA791O21.3;C9orf108;C9orf47;EDG-3;EDG3;endothelial differentiation G-protein coupled receptor 3;endothelial differentiation, sphingolipid G-protein-coupled receptor, 3;G protein-coupled receptor, endothelial differentiation gene-3;LPB3;S1P receptor 3;S1P receptor Edg-3;S1P receptor EDG3;S1P3;sphingosine 1-phosphate receptor 3;sphingosine 1-phosphate receptor Edg-3;uncharacterized protein C9orf47
- Weitere Details:
- This gene encodes a member of the EDG family of receptors, which are G protein-coupled receptors. This protein has been identified as a functional receptor for sphingosine 1-phosphate and likely contributes to the regulation of angiogenesis and vascular endothelial cell function.
- Versandbedingungen:
- Blue Ice