iNOS Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14031
Zusätzliche Namen:: HEP-NOS|INOS|NOS|NOS2A
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 130 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LNSLKPQDPVPCFVRNASGFHLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDSQHKGVRGGRMTLVFGCRRPDEDHIYQEEMLEMAQKGVLHAVHTAYSRLPGKPKVYVQDILRQQLASEVLRVLHKEPGHLYVCGDVRMARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEAKKDRVAVQPSSLEMSAL
Uniprot:: P35228
Synonyme:: HEP-NOS;hepatocyte NOS;inducible NO synthase;inducible NOS;INOS;nitric oxide synthase 2, inducible;nitric oxide synthase 2A (inducible, hepatocytes);nitric oxide synthase, inducible;nitric oxide synthase, macrophage;NOS;NOS type II;NOS, type II;NOS2A;peptidyl-cysteine S-nitrosylase NOS2
Weitere Details:: Nitric oxide is a reactive free radical which acts as a biologic mediator in several processes, including neurotransmission and antimicrobial and antitumoral activities. This gene encodes a nitric oxide synthase which is expressed in liver and is inducible by a combination of lipopolysaccharide and certain cytokines. Three related pseudogenes are located within the Smith-Magenis syndrome region on chromosome 17.