MRE11 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14026
Zusätzliche Namen:: ATLD|HNGS1|MRE11|MRE11A|MRE11B
Anwendung:: ELISA, WB, IP
Molekulargewicht:: 81kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KGRKMNMHKIPLHTVRQFFMEDIVLANHPDIFNPDNPKVTQAIQSFCLEKIEEMLENAERERLGNSHQPEKPLVRLRVDYSGGFEPFSVLRFSQKFVDRVANPKDIIHFFRHREQKEKTGEEINFGKLITKPSEGTTLRVEDLVKQYFQTAEKNVQLSLLTERGMGEAVQEFVDKEEKDAIEELVKYQLEKTQRFL
Uniprot:: P49959
Synonyme:: AT-like disease;ATLD;DNA recombination and repair protein;double-strand break repair protein MRE11;double-strand break repair protein MRE11A;endo/exonuclease Mre11;HNGS1;meiotic recombination 11 homolog 1;meiotic recombination 11 homolog A;MRE11 double strand break repair nuclease A;MRE11 homolog 1;MRE11 homolog A, double strand break repair nuclease;MRE11 homolog, double strand break repair nuclease A;MRE11 meiotic recombination 11 homolog A;MRE11 meiotic recombination 11-like protein A;MRE11A;MRE11B
Weitere Details:: This gene encodes a nuclear protein involved in homologous recombination, telomere length maintenance, and DNA double-strand break repair. By itself, the protein has 3' to 5' exonuclease activity and endonuclease activity. The protein forms a complex with the RAD50 homolog; this complex is required for nonhomologous joining of DNA ends and possesses increased single-stranded DNA endonuclease and 3' to 5' exonuclease activities. In conjunction with a DNA ligase, this protein promotes the joining of noncomplementary ends in vitro using short homologies near the ends of the DNA fragments. This gene has a pseudogene on chromosome 3. Alternative splicing of this gene results in two transcript variants encoding different isoforms.

Versandbedingungen:: Blue Ice