Stathmin 1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14018
Zusätzliche Namen:: C1orf215|Lag|LAP18|OP18|PP17|PP19|PR22|SMN|Stathmin 1
Anwendung:: ELISA, WB
Molekulargewicht:: 17kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD
Uniprot:: P16949
Synonyme:: C1orf215;Lag;LAP18;leukemia-associated phosphoprotein p18;metablastin;oncoprotein 18;OP18;phosphoprotein 19;phosphoprotein p19;PP17;PP19;PR22;prosolin;Protein Pr22;SMN;stathmin;stathmin 1/oncoprotein 18;testicular tissue protein Li 189;transmembrane protein C1orf215
Weitere Details:: This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene.