A14017
[KO Validated] LAMP2 Rabbit polyclonal antibody

Größe
Auf Anfrage
- SKU:
- A14017
- Zusätzliche Namen:
- CD107b|DND|LAMP-2|LAMPB|LGP-96|LGP110|P2
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 100-130kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- ELNLTDSENATCLYAKWQMNFTVRYETTNKTYKTVTISDHGTVTYNGSICGDDQNGPKIAVQFGPGFSWIANFTKAASTYSIDSVSFSYNTGDNTTFPDAEDKGILTVDELLAIRIPLNDLFRCNSLSTLEKNDVVQHYWDVLVQAFVQNGTVSTNEFLCDKDKTSTVAPTIHTTVPSPTTTPTPKEKPEAGTYSVNNGNDTCLLATMGLQLNITQDKVASVININPNTTHSTGSCRSHTALLRLNSSTIKYLDFVFAVKNENRFYLKEVN
- Uniprot:
- P13473
- Synonyme:
- CD107 antigen-like family member B;CD107b;DND;LAMP-2;LAMPB;LGP-96;LGP110;lysosome-associated membrane glycoprotein 2
- Weitere Details:
- The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may play a role in tumor cell metastasis. It may also function in the protection, maintenance, and adhesion of the lysosome. Alternative splicing of this gene results in multiple transcript variants encoding distinct proteins.
- Versandbedingungen:
- Blue Ice
![[KO Validated] LAMP2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A14017/A14017_1.jpg)
![[KO Validated] LAMP2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A14017/A14017_2.jpg)
![[KO Validated] LAMP2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A14017/A14017_3.jpg)
![[KO Validated] LAMP2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A14017/A14017_N12351-4_WB_01.jpg)
![[KO Validated] LAMP2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A14017/A14017_N12351-4_KO-WB_01.jpg)
![[KO Validated] LAMP2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A14017/A14017_N12351-4_IHC_01.jpg)