A14010
KCNJ4 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A14010
- Zusätzliche Namen:
- HIR|HIRK2|HRK1|IRK-3|IRK3|KCNJ4|Kir2.3
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 49kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- CVDTRWRYMLMIFSAAFLVSWLFFGLLFWCIAFFHGDLEASPGVPAAGGPAAGGGGAAPVAPKPCIMHVNGFLGAFLFSVETQTTIGYGFRCVTEECPLAV
- Uniprot:
- P48050
- Synonyme:
- Hippocampal inward rectifier;hippocampal inward rectifier potassium channel;HIR;HIRK2;HRK1;inward rectifier K(+) channel Kir2.3;inward rectifier potassium channel 4;IRK-3;IRK3;Kir2.3;Potassium channel, inwardly rectifying subfamily J member 4;potassium channel, inwardly rectifying subfamily J, member 4;potassium voltage-gated channel subfamily J member 4
- Weitere Details:
- Several different potassium channels are known to be involved with electrical signaling in the nervous system. One class is activated by depolarization whereas a second class is not. The latter are referred to as inwardly rectifying K+ channels, and they have a greater tendency to allow potassium to flow into the cell rather than out of it. This asymmetry in potassium ion conductance plays a key role in the excitability of muscle cells and neurons. The protein encoded by this gene is an integral membrane protein and member of the inward rectifier potassium channel family. The encoded protein has a small unitary conductance compared to other members of this protein family. Two transcript variants encoding the same protein have been found for this gene.
- Versandbedingungen:
- Blue Ice



