IFIT3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A14004
Zusätzliche Namen:: Ifi49|IFIT3|P49
Anwendung:: ELISA, WB
Molekulargewicht:: 60kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: YAWIYYHMGRLSEAQAYVDKVRQVCQKFANPYSMECPELECEEGWTRLKCGRNERAKMCFEKALEEKPKDPECSSGMAIAMFRLEEKPEKQFSVDALKQAM
Uniprot:: O14879
Synonyme:: CIG-49;cig41;CIG49;GARG-49;glucocorticoid-attenuated response gene 49 protein;Ifi;IFI-60K;Ifi49;IFI60;IFIT-3;IFIT-4;IFIT4;interferon-induced 60 kDa protein;interferon-induced protein with tetratricopeptide repeats 3;interferon-induced protein with tetratricopeptide repeats 4;IRG2;ISG-60;ISG60;P49;P60;retinoic acid-induced gene G protein;RIG-G
Weitere Details:: Predicted to enable RNA binding activity and identical protein binding activity. Acts upstream of or within cellular response to interferon-beta; response to bacterium; and response to stilbenoid. Predicted to be located in mitochondrion. Predicted to be active in cytosol. Is expressed in alimentary system; eye; face; and nervous system. Orthologous to human IFIT3 (interferon induced protein with tetratricopeptide repeats 3).