A13956
SLC25A20 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A13956
- Zusätzliche Namen:
- CAC|CACT|SLC25A20
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 33kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MADQPKPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQ
- Uniprot:
- O43772
- Synonyme:
- CAC;CACT;Carnitine/acylcarnitine translocase;mitochondrial carnitine/acylcarnitine carrier protein;solute carrier family 25 (carnitine/acylcarnitine translocase), member 20;Solute carrier family 25 member 20
- Weitere Details:
- This gene product is one of several closely related mitochondrial-membrane carrier proteins that shuttle substrates between cytosol and the intramitochondrial matrix space. This protein mediates the transport of acylcarnitines into mitochondrial matrix for their oxidation by the mitochondrial fatty acid-oxidation pathway. Mutations in this gene are associated with carnitine-acylcarnitine translocase deficiency, which can cause a variety of pathological conditions such as hypoglycemia, cardiac arrest, hepatomegaly, hepatic dysfunction and muscle weakness, and is usually lethal in new born and infants.
- Versandbedingungen:
- Blue Ice



