A13951
ATR Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A13951
- Zusätzliche Namen:
- ATR|FCTCS|FRP1|MEC1|SCKL|SCKL1
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 301kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LKMESMEIIEEIQCQTQQENLSSNSDGISPKRRRLSSSLNPSKRAPKQTEEIKHVDMNQKSILWSALKQKAESLQISLEYSGLKNPVIEMLEGIAVVLQLT
- Uniprot:
- Q13535
- Synonyme:
- ataxia telangiectasia and Rad3-related protein;FCTCS;FRAP-related protein 1;FRAP-related protein-1;FRP1;MEC1;MEC1, mitosis entry checkpoint 1, homolog;SCKL;SCKL1;serine/threonine-protein kinase ATR
- Weitere Details:
- The protein encoded by this gene is a serine/threonine kinase and DNA damage sensor, activating cell cycle checkpoint signaling upon DNA stress. The encoded protein can phosphorylate and activate several proteins involved in the inhibition of DNA replication and mitosis, and can promote DNA repair, recombination, and apoptosis. This protein is also important for fragile site stability and centrosome duplication. Defects in this gene are a cause of Seckel syndrome 1.
- Versandbedingungen:
- Blue Ice