RhoA Rabbit polyclonal antibody

Größe

£152.00

SKU:: A13947
Zusätzliche Namen:: ARH12|ARHA|EDFAOB|RHO12|RhoA|RHOH12
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 21kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: NIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL
Uniprot:: P61586
Synonyme:: Aplysia ras-related homolog 12;ARH12;ARHA;EDFAOB;epididymis secretory sperm binding protein;oncogene RHO H12;Rho cDNA clone 12;RHO12;RHOH12;small GTP binding protein RhoA;transforming protein RhoA
Weitere Details:: This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants have been identified.