A13939
CBP80 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A13939
- Zusätzliche Namen:
- CBP80|NCBP|Sto1
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 100kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MSRRRHSDENDGGQPHKRRKTSDANETEDHLESLICKVGEKSACSLESNLEGLAGVLEADLPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYNF
- Uniprot:
- Q09161
- Synonyme:
- 80 kDa nuclear cap-binding protein;CBP80;NCBP;NCBP 80 kDa subunit;nuclear cap binding protein subunit 1, 80kDa;nuclear cap-binding protein subunit 1;Sto1
- Weitere Details:
- The product of this gene is a component of the nuclear cap-binding protein complex (CBC), which binds to the monomethylated 5' cap of nascent pre-mRNA in the nucleoplasm. The encoded protein promotes high-affinity mRNA-cap binding and associates with the CTD of RNA polymerase II. The CBC promotes pre-mRNA splicing, 3'-end processing, RNA nuclear export, and nonsense-mediated mRNA decay.
- Versandbedingungen:
- Blue Ice