UBE2E1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A13912
Zusätzliche Namen:: UBCH6|UBE2E1
Anwendung:: ELISA, WB
Molekulargewicht:: 21kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAK
Uniprot:: P51965
Synonyme:: (E3-independent) E2 ubiquitin-conjugating enzyme E1;E2 ubiquitin-conjugating enzyme E1;UBCH6;ubiquitin carrier protein E1;ubiquitin conjugating enzyme E2E 1;ubiquitin-conjugating enzyme E2 E1;ubiquitin-conjugating enzyme E2E 1 (homologous to yeast UBC4/5);ubiquitin-conjugating enzyme E2E 1 (UBC4/5 homolog, yeast);ubiquitin-protein ligase E1
Weitere Details:: The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Three alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.