A13899
ZBP1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A13899
- Zusätzliche Namen:
- C20orf183|DAI|DLM-1|DLM1|ZBP1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 45kDa/58kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPEGEGPAELALSSPAERPQQHAATIPETPGPQFSQQREEDIYRFLKDNGPQRALVIAQALGMRTAKDVNRDLYRMKSRHLLDMDEQSKAWTIYRPEDS
- Uniprot:
- Q9H171
- Synonyme:
- C20orf183;DAI;DLM-1;DLM1;DNA-dependent activator of IRFs;tumor stroma and activated macrophage protein DLM-1;Z-DNA-binding protein 1
- Weitere Details:
- This gene encodes a Z-DNA binding protein. The encoded protein plays a role in the innate immune response by binding to foreign DNA and inducing type-I interferon production. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
- Versandbedingungen:
- Blue Ice