TRIM9 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A13896
Zusätzliche Namen:: RNF91|SPRING|TRIM9
Anwendung:: ELISA, WB
Molekulargewicht:: 79kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQ
Uniprot:: Q9C026
Synonyme:: E3 ubiquitin-protein ligase TRIM9;homolog of rat RING finger Spring;RING finger protein 91;RING-type E3 ubiquitin transferase TRIM9;RNF91;SNAP-25-interacting RING finger protein;SPRING;tripartite motif-containing protein 9
Weitere Details:: The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. Its function has not been identified. Alternate splicing of this gene generates two transcript variants encoding different isoforms.