A13864
PLA2G7 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A13864
- Zusätzliche Namen:
- LDL-PLA2|LP-PLA2|PAFAD|PAFAH|PLA2G7
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 55kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- FGQTKIPRGNGPYSVGCTDLMFDHTNKGTFLRLYYPSQDNDRLDTLWIPNKEYFWGLSKFLGTHWLMGNILRLLFGSMTTPANWNSPLRPGEKYPLVVFSHGLGAFRTLYSAIGIDLASHGFIVAAVEHRDRSASATYYFKDQSAAEIGDKSWLYLRTLKQEEETHIRNEQVRQRAKECSQALSLILDID
- Uniprot:
- Q13093
- Synonyme:
- 1-alkyl-2-acetylglycerophosphocholine esterase;2-acetyl-1-alkylglycerophosphocholine esterase;group-VIIA phospholipase A2;gVIIA-PLA2;LDL-associated phospholipase A2;LDL-PLA(2);LDL-PLA2;lipoprotein-associated phospholipase A2;LP-PLA2;PAF 2-acylhydrolase;PAF acetylhydrolase;PAFAD;PAFAH;phospholipase A2, group VII (platelet-activating factor acetylhydrolase, plasma);platelet-activating factor acetylhydrolase
- Weitere Details:
- The protein encoded by this gene is a secreted enzyme that catalyzes the degradation of platelet-activating factor to biologically inactive products. Defects in this gene are a cause of platelet-activating factor acetylhydrolase deficiency. Two transcript variants encoding the same protein have been found for this gene.
- Versandbedingungen:
- Blue Ice

