A13839
CRACR2A Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A13839
- Zusätzliche Namen:
- CRACR2A|EFCAB4B|RAB46
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 45kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAAPDGRVVSRPQRLGQGSGQGPKGSGACLHPLDSLEQKETQEQTSGQLVMLRKAQEFFQTCDAEGKGFIARKDMQRLHKELPLSLEELEDVFDALDADGNGYLTPQEFTTGFSHFFFSQNNPSQEDAGEQVAQRHEEKVYLSRGDEDLGDMGEDEEAQFRMLMDRLGAQKVLEDESDVKQLWLQLKKEEPHLLSNFEDF
- Uniprot:
- Q9BSW2
- Synonyme:
- Ca2+ release-activated Ca2+ (CRAC) channel regulator 2A;calcium release-activated calcium channel regulator 2A;Calcium release-activated channel regulator 2A;CRAC channel regulator 2A;CRAC regulator 2A;EF-hand calcium binding domain 4B;EF-hand calcium-binding domain-containing protein 4B;EFCAB4B;RAB46;ras-related protein Rab-46
- Weitere Details:
- Enables GTPase activity and calcium ion binding activity. Involved in several processes, including activation of store-operated calcium channel activity; positive regulation of JNK cascade; and store-operated calcium entry. Located in several cellular components, including Golgi apparatus; Weibel-Palade body; and immunological synapse.
- Versandbedingungen:
- Blue Ice

