[KO Validated] NDUFB4 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A13820
Zusätzliche Namen:: B15|B4|CI-B15
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 15kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSFPKYKPSSLRTLPETLDPAEYNISPETRRAQAERLAIRAQLKREYLLQYNDPNRRGLIENPALLRWAYARTINVYPNFRPTPKNSLMG
Uniprot:: O95168
Synonyme:: B15;CI-B15;complex I B15 subunit;complex I-B15;NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 4, 15kDa;NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4;NADH-ubiquinone oxidoreductase B15 subunit
Weitere Details:: This gene encodes a non-catalytic subunit of the multisubunit NADH:ubiquinone oxidoreductase, the first enzyme complex in the mitochondrial electron transport chain (complex I). Mammalian complex I is composed of 45 different subunits and transfers electrons from NADH to ubiquinone.