ARPC2 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A1382
Zusätzliche Namen:: ARC34|ARPC2|p34-Arc|PNAS-139|PRO2446
Anwendung:: ELISA, WB, IF, ICC, IP
Molekulargewicht:: 34kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: FSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR
Uniprot:: O15144
Synonyme:: actin related protein 2/3 complex, subunit 2, 34kDa;actin-related protein 2/3 complex subunit 2;ARC34;arp2/3 complex 34 kDa subunit;ARP2/3 protein complex subunit 34;p34-Arc;PNAS-139;PRO2446;testis tissue sperm-binding protein Li 53e
Weitere Details:: This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p34 subunit, has yet to be determined. Two alternatively spliced variants have been characterized to date. Additional alternatively spliced variants have been described but their full length nature has not been determined.