UBR5 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A13816
Zusätzliche Namen:: DD5|EDD|EDD1|HYD|UBR5
Anwendung:: ELISA, WB
Molekulargewicht:: 300kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SISAGIPKVGVLMESVWNMNDSCRFQLRSPESLKNMEKASKTTEAKPESKQEPVKTEMGPPPSPASTCSDASSIASSASMPYKRRRSTPAPKEEEKVNEEQWSLREVVFVEDVKNVPVGKVLKVDGAYVAVKFPGTSSNTNCQNSSGPDADPSSLLQDCRLLRIDELQVVKTGGTPKVPDCFQRTPKKLCIPEKTEILAVNVDSKGVHAVL
Uniprot:: O95071
Synonyme:: DD5;E3 identified by differential display;E3 ubiquitin-protein ligase UBR5;E3 ubiquitin-protein ligase, HECT domain-containing 1;EDD;EDD1;HECT-type E3 ubiquitin transferase UBR5;HYD;hyperplastic discs protein homolog;progestin-induced protein
Weitere Details:: This gene encodes a progestin-induced protein, which belongs to the HECT (homology to E6-AP carboxyl terminus) family. The HECT family proteins function as E3 ubiquitin-protein ligases, targeting specific proteins for ubiquitin-mediated proteolysis. This gene is localized to chromosome 8q22 which is disrupted in a variety of cancers. This gene potentially has a role in regulation of cell proliferation or differentiation.