FCRL5 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A13803
Zusätzliche Namen:: BXMAS1|CD307|CD307e|FCRH5|FCRL5|IRTA2|PRO820
Anwendung:: ELISA, WB
Molekulargewicht:: 106kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: QFARTPRPIIFLQPPWTTVFQGERVTLTCKGFRFYSPQKTKWYHRYLGKEILRETPDNILEVQESGEYRCQAQGSPLSSPVHLDFSSASLILQAPLSVFEGDSVVLRCRAKAEVTLNNTIYKNDNVLAFLNKRTDFHIPHACLKDNGAYRCTGYKESCCPVSSNTVKIQVQEPFT
Uniprot:: Q96RD9
Synonyme:: BXMAS1;CD307;CD307e;fc receptor homolog 5;Fc receptor-like protein 5;fcR-like protein 5;FCRH5;immune receptor translocation-associated protein 2;immunoglobulin superfamily receptor translocation associated 2 (IRTA2);IRTA2;PRO820
Weitere Details:: This gene encodes a member of the immunoglobulin receptor superfamily and the Fc-receptor like family. This gene and several other Fc receptor-like gene members are clustered on the long arm of chromosome 1. The encoded protein is a single-pass type I membrane protein and contains 8 immunoglobulin-like C2-type domains. This gene is implicated in B cell development and lymphomagenesis. Alternatively spliced transcript variants encoding different isoforms have been identified.