A13800
GRIK4 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A13800
- Zusätzliche Namen:
- EAA1|GluK4|GluK4-2|GRIK|GRIK4|KA1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 100kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLGKAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFKVAPEEFVKFQFQRFTTLNLHPSNTDISVAVAGILNFFNCTTACLICAKAECLLNLEKLLRQFLISKDTLSVRMLDDTRDPTPLLKEIRDDKTATIIIHAN
- Uniprot:
- Q16099
- Synonyme:
- EAA1;excitatory amino acid receptor 1;GluK4;GluK4-2;GluK4(alt_5'UTR);glutamate receptor ionotropic, kainate 4;Glutamate receptor KA-1;glutamate receptor KA1;glutamate receptor, ionotropic, kainate 4;GRIK;KA1;putative NMDtranscript(altAcc_e11)
- Weitere Details:
- This gene encodes a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. The protein encoded by this gene forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice