ELMO2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A13785
Zusätzliche Namen:: CED-12|Ced-12A|CED12|ELMO-2|ELMO2|VMPI
Anwendung:: ELISA, WB
Molekulargewicht:: 83kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SLPNPEYYTLRYADGPQLYITEQTRSDIKNGTILQLAISPSRAARQLMERTQSSNMETRLDAMKELAKLSADVTFATEF
Uniprot:: Q96JJ3
Synonyme:: CED-12;ced-12 homolog 2;Ced-12A;CED12;ELMO-2;engulfment and cell motility protein 2;PH domain protein CED12A;protein ced-12 homolog A;VMPI
Weitere Details:: The protein encoded by this gene interacts with the dedicator of cyto-kinesis 1 protein. Similarity to a C. elegans protein suggests that this protein may function in phagocytosis of apoptotic cells and in cell migration. Alternative splicing results in multiple transcript variants.