PAPSS1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A13773
Zusätzliche Namen:: ATPSK1|PAPSS|PAPSS1|SK1
Anwendung:: ELISA, WB
Molekulargewicht:: 71kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SEYEKPEAPELVLKTDSCDVNDCVQQVVELLQERDIVPVDASYEVKELYVPENKLHLAKTDAETLPALKIN
Uniprot:: O43252
Synonyme:: 3-prime-phosphoadenosine 5-prime-phosphosulfate synthase 1;adenylyl-sulfate kinase;ATPSK1;bifunctional 3'-phosphoadenosine 5'-phosphosulfate synthase 1;PAPS synthase 1;PAPSS;PAPSS 1;SK 1;SK1;sulfate adenylyltransferase;sulfurylase kinase 1
Weitere Details:: Three-prime-phosphoadenosine 5-prime-phosphosulfate (PAPS) is the sulfate donor cosubstrate for all sulfotransferase (SULT) enzymes (Xu et al., 2000 [PubMed 10679223]). SULTs catalyze the sulfate conjugation of many endogenous and exogenous compounds, including drugs and other xenobiotics. In humans, PAPS is synthesized from adenosine 5-prime triphosphate (ATP) and inorganic sulfate by 2 isoforms, PAPSS1 and PAPSS2 (MIM 603005).