IFIT2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A13760
Zusätzliche Namen:: cig42|G10P2|GARG-39|IFI-54|IFI-54K|IFI54|IFIT-2|IFIT2|ISG-54|ISG-54 K|ISG-54K|ISG54|P54
Anwendung:: ELISA, WB
Molekulargewicht:: 50 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ALEYIPNNAYLHCQIGCCYRAKVFQVMNLRENGMYGKRKLLELIGHAVAHLKKADEANDNLFRVCSILASLHALADQYEDAEYYFQKEFSKELTPVAKQLLHLRYGNFQLYQMKCEDKAIHHFIEGVKINQKSREKEKMKDKLQKIAKMRLSKNGADSEALHVLAFLQELNEKMQQADEDSERGLESGSLIPSASSWNGE
Uniprot:: P09913
Synonyme:: cig42;G10P2;GARG-39;IFI-54;IFI-54K;IFI54;IFIT-2;interferon-induced 54 kDa protein;interferon-induced protein 54;interferon-induced protein with tetratricopeptide repeats 2;Interferon, alpha-inducible protein (MW 54kD);ISG-54;ISG-54 K;ISG-54K;ISG54;P54
Weitere Details:: Enables RNA binding activity. Involved in negative regulation of protein binding activity; positive regulation of apoptotic process; and response to virus. Located in endoplasmic reticulum.