SERPINB13 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A13744
Zusätzliche Namen:: headpin|HSHUR7SEQ|HUR7|PI13|SERPINB13
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 44kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MDSLGAVSTRLGFDLFKELKKTNDGNIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSEKETKSSRIKAEEKEVIENTEAVHQQFQKFLTEISKLTNDYELNITNRLFGEKTYLFLQKYLDYVEKYYHASLEPVDFVNA
Uniprot:: Q9UIV8
Synonyme:: haCaT UV-repressible serpin;headpin;HSHUR7SEQ;HUR7;HURPIN;peptidase inhibitor 13;PI-13;PI13;protease inhibitor 13 (hurpin, headpin);proteinase inhibitor 13;serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 13;serpin B13;serpin peptidase inhibitor, clade B (ovalbumin), member 13;UV-B repressed sequence, HUR 7
Weitere Details:: The protein encoded by this gene is a member of the serpin family of serine protease inhibitors. The encoded protein inhibits the activity of cathepsin K and is itself transcriptionally repressed by RUNX1. This gene is downregulated in many types of cancer.