A13742
IDH3B Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A13742
- Zusätzliche Namen:
- IDH3B|RP46
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 42kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- ASRSQAEDVRVEGSFPVTMLPGDGVGPELMHAVKEVFKAAAVPVEFQEHHLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGE
- Uniprot:
- O43837
- Synonyme:
- isocitrate dehydrogenase (NAD(+)) 3 beta;isocitrate dehydrogenase [NAD] subunit beta, mitochondrial;isocitrate dehydrogenase 3 (NAD(+)) beta;isocitrate dehydrogenase 3 (NAD+) beta;isocitric dehydrogenase subunit beta;NAD(+)-specific ICDH subunit beta;RP46
- Weitere Details:
- Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the beta subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene.
- Versandbedingungen:
- Blue Ice