A1372
UCHL3 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A1372
- Zusätzliche Namen:
- UCH-L3|UCHL3
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 26kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGL
- Uniprot:
- P15374
- Synonyme:
- testicular tissue protein Li 221;ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase);ubiquitin carboxyl-terminal hydrolase isozyme L3;ubiquitin thioesterase L3;ubiquitin thiolesterase;UCH-L3
- Weitere Details:
- The protein encoded by this gene is a member of the deubiquitinating enzyme family. Members of this family are proteases that catalyze the removal of ubiquitin from polypeptides and are divided into five classes, depending on the mechanism of catalysis. This protein may hydrolyze the ubiquitinyl-N-epsilon amide bond of ubiquitinated proteins to regenerate ubiquitin for another catalytic cycle. Alternative splicing results in multiple transcript variants that encode different protein isoforms.
- Versandbedingungen:
- Blue Ice