RND1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A13705
Zusätzliche Namen:: ARHS|RHO6|RHOS|RND1
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 26kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLNKPSPLPQKSPVRSLSKRLLHLPSRSELISSTFKKEKAKSCSIM
Uniprot:: Q92730
Synonyme:: ARHS;ras homolog gene family, member S;Rho family GTPase 1;rho-related GTP-binding protein Rho6;RHO6;RHOS;Rnd1
Weitere Details:: This gene encodes a protein that belongs to the Rho GTPase family. Members of this family regulate the organization of the actin cytoskeleton in response to extracellular growth factors. A similar protein in rat interacts with a microtubule regulator to control axon extension.