CABP7 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A13703
Zusätzliche Namen:: CABP7|CALN2
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 30kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PKLSTSGIPEKFHGTDFDTVFWKCDMQKLTVDELKRLLYDTFCEHLSMKDIENIIMTEEESHLGTAEECPVDVETCSNQQI
Uniprot:: Q86V35
Synonyme:: calcium-binding protein 7;CALN2;calneuron 2;calneuron II;Calneuron-2
Weitere Details:: Predicted to enable calcium ion binding activity. Located in trans-Golgi network membrane.