A13700
THOC7 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A13700
- Zusätzliche Namen:
- fSAP24|hTREX30|NIF3L1BP1|THOC7
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 24kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MGAVTDDEVIRKRLLIDGDGAGDDRRINLLVKSFIKWCNSGSQEEGYSQYQRMLSTLSQCEFSMGKTLLVYDMNLREMENYEKIYKEIECSIAGAHEKIAECKKQILQAKRIRKNRQEYDALAKVIQHHPDRHETLKELEALGKELEHLSHIKESVEDKLELRRKQFHVLLSTIHELQQTLENDEKLSEVEEAQEASMETDPKP
- Uniprot:
- Q6I9Y2
- Synonyme:
- fSAP24;functional spliceosome-associated protein 24;hTREX30;Ngg1 interacting factor 3 like 1 binding protein 1;ngg1-interacting factor 3-like protein 1-binding protein 1;NIF3L1-binding protein 1;NIF3L1BP1;THO complex 7 homolog;THO complex subunit 7 homolog
- Weitere Details:
- Predicted to enable RNA binding activity. Involved in mRNA export from nucleus and viral mRNA export from host cell nucleus. Located in cytosol and nuclear speck. Part of THO complex part of transcription export complex. Colocalizes with chromosome, telomeric region.
- Versandbedingungen:
- Blue Ice

