THOC7 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A13700
Zusätzliche Namen:: fSAP24|hTREX30|NIF3L1BP1|THOC7
Anwendung:: ELISA, WB
Molekulargewicht:: 24kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MGAVTDDEVIRKRLLIDGDGAGDDRRINLLVKSFIKWCNSGSQEEGYSQYQRMLSTLSQCEFSMGKTLLVYDMNLREMENYEKIYKEIECSIAGAHEKIAECKKQILQAKRIRKNRQEYDALAKVIQHHPDRHETLKELEALGKELEHLSHIKESVEDKLELRRKQFHVLLSTIHELQQTLENDEKLSEVEEAQEASMETDPKP
Uniprot:: Q6I9Y2
Synonyme:: fSAP24;functional spliceosome-associated protein 24;hTREX30;Ngg1 interacting factor 3 like 1 binding protein 1;ngg1-interacting factor 3-like protein 1-binding protein 1;NIF3L1-binding protein 1;NIF3L1BP1;THO complex 7 homolog;THO complex subunit 7 homolog
Weitere Details:: Predicted to enable RNA binding activity. Involved in mRNA export from nucleus and viral mRNA export from host cell nucleus. Located in cytosol and nuclear speck. Part of THO complex part of transcription export complex. Colocalizes with chromosome, telomeric region.