CLIC1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A13684
Zusätzliche Namen:: CL1C1|CLCNL1|CLIC1|G6|NCC27
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 27kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: NVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSNPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
Uniprot:: O00299
Synonyme:: chloride channel ABP;chloride intracellular channel protein 1;CL1C1;CLCNL1;G6;hRNCC;NCC27;nuclear chloride ion channel 27;nuclear chloride ion channel protein;p64CLCP;regulatory nuclear chloride ion channel protein;RNCC protein
Weitere Details:: Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity.