KLF4 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A13673
Zusätzliche Namen:: EZF|GKLF|KLF4
Anwendung:: ELISA, WB, IHC-P, IF, ICC, IP
Molekulargewicht:: 55 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human KLF4 (O43474).
Formulierung:: Unmodified
Sequenz:: PAAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPSFLPDQMQPQVPPLHYQGQSRGFVARAGEPCVCWPHFGTHGMMLTPPSSPL
Uniprot:: O43474
Synonyme:: endothelial Kruppel-like zinc finger protein;epithelial zinc finger protein EZF;EZF;GKLF;gut Kruppel-like factor;gut-enriched krueppel-like factor;Krueppel-like factor 4;Kruppel-like factor 4 (gut)
Weitere Details:: This gene encodes a protein that belongs to the Kruppel family of transcription factors. The encoded zinc finger protein is required for normal development of the barrier function of skin. The encoded protein is thought to control the G1-to-S transition of the cell cycle following DNA damage by mediating the tumor suppressor gene p53. Mice lacking this gene have a normal appearance but lose weight rapidly, and die shortly after birth due to fluid evaporation resulting from compromised epidermal barrier function. Alternative splicing results in multiple transcript variants encoding different isoforms.