A13665
Pin1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A13665
- Zusätzliche Namen:
- DOD|Pin1|UBL5
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 18kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
- Uniprot:
- Q13526
- Synonyme:
- DOD;peptidyl-prolyl cis-trans isomerase NIMA-interacting 1;Peptidyl-prolyl cis-trans isomerase Pin1;PPIase Pin1;protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting 1;protein interacting with never in mitosis A1;rotamase Pin1;UBL5
- Weitere Details:
- Peptidyl-prolyl cis/trans isomerases (PPIases) catalyze the cis/trans isomerization of peptidyl-prolyl peptide bonds. This gene encodes one of the PPIases, which specifically binds to phosphorylated ser/thr-pro motifs to catalytically regulate the post-phosphorylation conformation of its substrates. The conformational regulation catalyzed by this PPIase has a profound impact on key proteins involved in the regulation of cell growth, genotoxic and other stress responses, the immune response, induction and maintenance of pluripotency, germ cell development, neuronal differentiation, and survival. This enzyme also plays a key role in the pathogenesis of Alzheimer's disease and many cancers. Multiple alternatively spliced transcript variants have been found for this gene.
- Versandbedingungen:
- Blue Ice



