A13630
PSMB2 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A13630
- Zusätzliche Namen:
- HC7-I|PSMB2
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC, IP
- Molekulargewicht:
- 23kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS
- Uniprot:
- P49721
- Synonyme:
- HC7-I;macropain subunit C7-I;multicatalytic endopeptidase complex subunit C7-1;multicatalytic endopeptidase complex subunit C7-I;proteasome (prosome, macropain) subunit, beta type, 2;proteasome beta 2 subunit;proteasome component C7-I;proteasome subunit beta 2;proteasome subunit beta type-2;proteasome subunit beta4;proteasome subunit, beta type, 2;testicular tissue protein Li 152
- Weitere Details:
- The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice







