A13612
Thymidine Kinase 1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A13612
- Zusätzliche Namen:
- Thymidine Kinase 1|TK2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 26kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MSCINLPTVLPGSPSKTRGQIQVILGPMFSGKSTELMRRVRRFQIAQYKCLVIKYAKDTRYSSSFCTHDRNTMEALPACLLRDVAQEALGVAVIGIDEGQ
- Uniprot:
- P04183
- Synonyme:
- cytosolic thymidine kinase;epididymis secretory sperm binding protein;thymidine kinase, cytosolic;TK2
- Weitere Details:
- The protein encoded by this gene is a cytosolic enzyme that catalyzes the addition of a gamma-phosphate group to thymidine. This creates dTMP and is the first step in the biosynthesis of dTTP, which is one component required for DNA replication. The encoded protein, whose levels fluctuate depending on the cell cycle stage, can act as a low activity dimer or a high activity tetramer. High levels of this protein have been used as a biomarker for diagnosing and categorizing many types of cancers.
- Versandbedingungen:
- Blue Ice