PSMA6 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A13536
Zusätzliche Namen:: IOTA|p27K|PROS27|PSMA6
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 27kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD
Uniprot:: P60900
Synonyme:: 27 kDa prosomal protein;IOTA;macropain iota chain;macropain subunit iota;multicatalytic endopeptidase complex iota chain;p27K;PROS-27;PROS27;prosomal P27K protein;proteasome (prosome, macropain) subunit, alpha type, 6;proteasome iota chain;proteasome subunit alpha 6;proteasome subunit alpha type-6;proteasome subunit alpha1;proteasome subunit iota;testicular secretory protein Li 44
Weitere Details:: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Multiple transcript variants encoding several different isoforms have been found for this gene. A pseudogene has been identified on the Y chromosome.

Versandbedingungen:: Blue Ice