A13522
NOTCH3 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A13522
- Zusätzliche Namen:
- CADASIL|CADASIL1|CASIL|IMF2|LMNS|NOTCH3
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 100 kDa(NTM)/270 kDa(FL)
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- TPVSPQERPPPYLAVPGHGEEYPAAGAHSSPPKARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSESTPSPATATGAMATTTGALPAQPLPLSVPSSLAQAQTQLGPQPEVTPKRQVLA
- Uniprot:
- Q9UM47
- Synonyme:
- CADASIL;CADASIL1;CASIL;IMF2;LMNS;neurogenic locus notch homolog protein 3;notch 3;Notch homolog 3
- Weitere Details:
- This gene encodes the third discovered human homologue of the Drosophilia melanogaster type I membrane protein notch. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signalling pathway that plays a key role in neural development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remains to be determined. Mutations in NOTCH3 have been identified as the underlying cause of cerebral autosomal dominant arteriopathy with subcortical infarcts and leukoencephalopathy (CADASIL).
- Versandbedingungen:
- Blue Ice





