A13513
MCM4 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A13513
- Zusätzliche Namen:
- CDC21|CDC54|hCdc21|IMD54|MCM4|NKCD|NKGCD|P1-CDC21
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 110kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- QMIKLQESPEDMPAGQTPHTVILFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKSVYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLK
- Uniprot:
- P33991
- Synonyme:
- CDC21;CDC21 homolog;CDC54;DNA replication licensing factor MCM4;hCdc21;homolog of S. pombe cell devision cycle 21;IMD54;minichromosome maintenance deficient 4;NKCD;NKGCD;P1-CDC21
- Weitere Details:
- The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 6 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of this protein by CDC2 kinase reduces the DNA helicase activity and chromatin binding of the MCM complex. This gene is mapped to a region on the chromosome 8 head-to-head next to the PRKDC/DNA-PK, a DNA-activated protein kinase involved in the repair of DNA double-strand breaks. Alternatively spliced transcript variants encoding the same protein have been reported.
- Versandbedingungen:
- Blue Ice

