HDAC4 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A13510
Zusätzliche Namen:: AHO3|BDMR|HA6116|HD4|HDAC-4|HDAC-A|HDAC4|HDACA|NEDCHF|NEDCHID
Anwendung:: ELISA, WB
Molekulargewicht:: 140kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLPVAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQL
Uniprot:: P56524
Synonyme:: AHO3;BDMR;HA6116;HD4;HDAC-4;HDAC-A;HDACA;histone deacetylase 4;histone deacetylase A
Weitere Details:: Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to class II of the histone deacetylase/acuc/apha family. It possesses histone deacetylase activity and represses transcription when tethered to a promoter. This protein does not bind DNA directly, but through transcription factors MEF2C and MEF2D. It seems to interact in a multiprotein complex with RbAp48 and HDAC3.