A13496
GSTM2 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A13496
- Zusätzliche Namen:
- GST4|GSTM|GSTM2|GSTM2-2|GTHMUS
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 27kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MPMTLGYWNIRGLAHSIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGESEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPRPVFTKMAVWGNK
- Uniprot:
- P28161
- Synonyme:
- epididymis secretory sperm binding protein;glutathione S-alkyltransferase M2;glutathione S-aralkyltransferase M2;glutathione S-aryltransferase M2;glutathione S-transferase 4;glutathione S-transferase M1;glutathione S-transferase M2 (muscle);glutathione S-transferase Mu 2;glutathione S-transferase mu 2 (muscle);GST class-mu 2;GST, muscle;GST4;GSTM;GSTM2-2;GTHMUS;S-(hydroxyalkyl)glutathione lyase M2
- Weitere Details:
- Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs.
- Versandbedingungen:
- Blue Ice

