A13485
CYP51A1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A13485
- Zusätzliche Namen:
- CP51|CYP51|CYP51A1|CYPL1|LDM|P450-14DM|P450L1
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- WLLPGWLPLPSFRRRDRAHREIKDIFYKAIQKRRQSQEKIDDILQTLLDATYKDGRPLTDDEVAGMLIGLLLAGQHTSSTTSAWMGFFLARDKTLQKKCYLEQKTVCGENLPPLTYDQLKDLNLLDRCIKETLRLRPPIMIMMRMARTPQTVAGYTIPPGHQVCVSPTVNQRLKDS
- Uniprot:
- Q16850
- Synonyme:
- CP51;CYP51;CYPL1;CYPLI;cytochrome P450 51A1;cytochrome P450-14DM;cytochrome P450, 51 (lanosterol 14-alpha-demethylase);cytochrome P450, family 51, subfamily A, polypeptide 1;cytochrome P45014DM;cytochrome P450LI;lanosterol 14-alpha demethylase;LDM;P450-14DM;P450L1;sterol 14-alpha demethylase
- Weitere Details:
- This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein participates in the synthesis of cholesterol by catalyzing the removal of the 14alpha-methyl group from lanosterol. Homologous genes are found in all three eukaryotic phyla, fungi, plants, and animals, suggesting that this is one of the oldest cytochrome P450 genes. Two transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice








