Annexin A4/Annexin IV Rabbit polyclonal antibody

Größe

£152.00

SKU:: A13466
Zusätzliche Namen:: Annexin A4/Annexin IV|ANX4|HEL-S-274|P32.5|PAP-II|PIG28|PP4-X|ZAP36
Anwendung:: ELISA, WB
Molekulargewicht:: 36kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: IEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD
Uniprot:: P09525
Synonyme:: 35-beta calcimedin;annexin A4;Annexin IV;annexin IV (placental anticoagulant protein II);annexin-4;ANX4;carbohydrate-binding protein p33/p41;chromobindin-4;endonexin I;epididymis secretory protein Li 274;HEL-S-274;lipocortin IV;P32.5;PAP-II;PIG28;placental anticoagulant protein II;PP4-X;proliferation-inducing gene 28;proliferation-inducing protein 28;protein II;ZAP36
Weitere Details:: Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells. Several transcript variants encoding different isoforms have been found for this gene.

Versandbedingungen:: Blue Ice