A13461
AK4 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A13461
- Zusätzliche Namen:
- AK 4|AK3|AK3L1|AK3L2|AK4
- Anwendung:
- ELISA, WB, IP
- Molekulargewicht:
- 25kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MASKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSGHFLRENIKASTEVGEMAKQYIEKSLLVPDHVITRLMMSELENRRGQHWLLDGFPRTLGQAEALDKICEVDLVISLNIPFETLKDRLSRRWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITPIQSKEAY
- Uniprot:
- P27144
- Synonyme:
- Adenylate kinase 3-like;adenylate kinase 3-like 1;adenylate kinase 4, mitochondrial;adenylate kinase isoenzyme 4, mitochondrial;AK 4;AK3;AK3L1;AK3L2;ATP-AMP transphosphorylase;epididymis secretory sperm binding protein;GTP:AMP phosphotransferase AK4;GTP:AMP phosphotransferase AK4, mitochondrial;mitochondrial adenylate kinase-3;nucleoside-triphosphate-adenylate kinase
- Weitere Details:
- This gene encodes a member of the adenylate kinase family of enzymes. The encoded protein is localized to the mitochondrial matrix. Adenylate kinases regulate the adenine and guanine nucleotide compositions within a cell by catalyzing the reversible transfer of phosphate group among these nucleotides. Five isozymes of adenylate kinase have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. A pseudogene for this gene has been located on chromosome 17. Three transcript variants encoding the same protein have been identified for this gene. Sequence alignment suggests that the gene defined by NM_013410, NM_203464, and NM_001005353 is located on chromosome 1.
- Versandbedingungen:
- Blue Ice



