A13410
CHMP2B Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A13410
- Zusätzliche Namen:
- ALS17|CHMP2.5|CHMP2B|DMT1|FTDALS7|VPS2-2|VPS2B
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 28kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKALGVD
- Uniprot:
- Q9UQN3
- Synonyme:
- ALS17;charged multivesicular body protein 2b;CHMP2.5;chromatin modifying protein 2B;Chromatin-modifying protein 2b;DMT1;FTDALS7;Vacuolar protein sorting-associated protein 2-2;vacuolar protein-sorting-associated protein 2-2;VPS2 homolog B;VPS2-2;VPS2B
- Weitere Details:
- This gene encodes a component of the heteromeric ESCRT-III complex (Endosomal Sorting Complex Required for Transport III) that functions in the recycling or degradation of cell surface receptors. ESCRT-III functions in the concentration and invagination of ubiquitinated endosomal cargos into intralumenal vesicles. The protein encoded by this gene is found as a monomer in the cytosol or as an oligomer in ESCRT-III complexes on endosomal membranes. It is expressed in neurons of all major regions of the brain. Mutations in this gene result in one form of familial frontotemporal lobar degeneration.
- Versandbedingungen:
- Blue Ice