A13359
TGM1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A13359
- Zusätzliche Namen:
- ARCI1|ICR2|KTG|LI|LI1|TGASE|TGK|TGM1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 90kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- AGDGTIREGMLVVNGVDLLSSRSDQNRREHHTDEYEYDELIVRRGQPFHMLLLLSRTYESSDRITLELLIGNNPEVGKGTHVIIPVGKGGSGGWKAQVVKASGQNLNLRVHTSPNAIIGKFQFTVRTQSDAGEFQLPFDPRNEIYILFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTE
- Uniprot:
- P22735
- Synonyme:
- ARCI1;epidermal TGase;ICR2;K polypeptide epidermal type I, protein-glutamine-gamma-glutamyltransferase;KTG;LI;LI1;protein-glutamine gamma-glutamyltransferase K;TG(K);TGASE;TGase K;TGase-1;TGK;transglutaminase K;Transglutaminase-1;transglutaminase, keratinocyte
- Weitere Details:
- The protein encoded by this gene is a membrane protein that catalyzes the addition of an alkyl group from an akylamine to a glutamine residue of a protein, forming an alkylglutamine in the protein. This protein alkylation leads to crosslinking of proteins and catenation of polyamines to proteins. This gene contains either one or two copies of a 22 nt repeat unit in its 3' UTR. Mutations in this gene have been associated with autosomal recessive lamellar ichthyosis (LI) and nonbullous congenital ichthyosiform erythroderma (NCIE).
- Versandbedingungen:
- Blue Ice