A13323
LLGL2 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A13323
- Zusätzliche Namen:
- 9130006H11Rik|LLGL2|Llglh2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 114kDa
- Spezies-Reaktivität:
- Mouse
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- DSTKAKKHNRPSNGNGTGLKMTSSGHVRNSKSQSDGDEKKPGPVMEHALLNDAWVLKEIQSTLEGDRRSYGNWHPHRVAVGCRLSNGEAE
- Synonyme:
- 9130006H11Rik;HGL;Hugl-2;human giant larvae homolog;lethal giant larvae homolog 2, scribble cell polarity complex component;lethal giant larvae-like protein 2;lethal(2) giant larvae protein homolog 2;LGL2;LLGL scribble cell polarity complex component 2;LLGL2, scribble cell polarity complex component;Llglh2
- Weitere Details:
- Predicted to enable GTPase activator activity; PDZ domain binding activity; and myosin II binding activity. Acts upstream of or within establishment or maintenance of polarity of embryonic epithelium; labyrinthine layer development; and post-embryonic development. Predicted to be located in cytosol and intracellular membrane-bounded organelle. Predicted to be active in cortical actin cytoskeleton and plasma membrane. Is expressed in several structures, including cardiovascular system; endocrine gland; genitourinary system; gut; and nasal cavity epithelium. Orthologous to human LLGL2 (LLGL scribble cell polarity complex component 2).
- Versandbedingungen:
- Blue Ice