A13318
IFRD1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A13318
- Zusätzliche Namen:
- IFRD1|PC4|TIS7
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 47kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MPKNKKRNTPHRGSSAGGGGSGAAAATAATAGGQHRNVQPFSDEDASIETMSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGLIDLTLDKSAKTRQAALEGIKNALASKMLYEFILERRMTLTDSIERCLKKGKSDEQRAAAALASVLCIQLGPGIESEEILKTLGPILKKIICDGSASMQARQTCATCFGVCCFIATDDITELYSTLECLENIFTKSYLKEKDTTVICSTPNTVL
- Uniprot:
- O00458
- Synonyme:
- 12-O-tetradecanoylphorbol-13-acetate-induced sequence 7;interferon-related developmental regulator 1;nerve growth factor-inducible protein PC4;PC4;pheochromocytoma cell-4;TIS7;TPA induced sequence 7
- Weitere Details:
- This gene is an immediate early gene that encodes a protein related to interferon-gamma. This protein may function as a transcriptional co-activator/repressor that controls the growth and differentiation of specific cell types during embryonic development and tissue regeneration. Mutations in this gene are associated with sensory/motor neuropathy with ataxia. This gene may also be involved in modulating the pathogenesis of cystic fibrosis lung disease. Alternate splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice

