A13264
AGER Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A13264
- Zusätzliche Namen:
- AGER|RAGE|SCARJ1|sRAGE
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 45kDa/55kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- GAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSF
- Uniprot:
- Q15109
- Synonyme:
- advanced glycosylation end product-specific receptor;RAGE;receptor for advanced glycation end-products variant 20;Receptor for advanced glycosylation end products;SCARJ1;sRAGE
- Weitere Details:
- The advanced glycosylation end product (AGE) receptor encoded by this gene is a member of the immunoglobulin superfamily of cell surface receptors. It is a multiligand receptor, and besides AGE, interacts with other molecules implicated in homeostasis, development, and inflammation, and certain diseases, such as diabetes and Alzheimer's disease. Many alternatively spliced transcript variants encoding different isoforms, as well as non-protein-coding variants, have been described for this gene (PMID:18089847).
- Versandbedingungen:
- Blue Ice

